BPC-157 TB500 Blend Nasal Spray
BPC-157 TB-500 Blend Nasal Spray is a pre-mixed liquid research preparation combining the synthetic peptides BPC-157 and TB-500 in a single formulation, and is available from Direct SARMs in 15 ml and 30 ml sizes.
Sale!
98.8% purityStore 2–8°C
Price range: $106.25 through $371.43
Buy more, save more
7.5% offspend $250.00
12.5% offspend $400.00
Spend $250.00 for 7.5% off on qualifying items · Applied automatically at checkout
Researchers who bought BPC-157 TB500 Blend Nasal Spray also bought
BPC-157 TB500 Blend Nasal Spray
BPC-157 and TB-500 are two distinct synthetic research peptides supplied together in a single formulation. BPC-157 is a 15-amino-acid peptide that has been investigated predominantly in preclinical studies examining cellular signalling, angiogenesis and processes associated with tissue repair. TB-500 commonly refers to the synthetic acetylated peptide fragment Ac-LKKTETQ, corresponding to residues 17–23 of thymosin beta-4. Research involving the TB-500 fragment should be distinguished from studies of full-length thymosin beta-4, as the two are not the same molecular entity.
Direct SARMs supplies the BPC-157 TB-500 Blend as a pre-mixed aqueous nasal spray format for laboratory and analytical research, available in 15 ml and 30 ml sizes with equal stated quantities of BPC-157 and TB-500 in each formulation. The two components have separate research histories, and their inclusion in a combined preparation should not be interpreted as establishing synergy or a combined biological effect.
The nasal spray designation describes the physical presentation of the research material and does not establish intranasal bioavailability, biological activity, safety or suitability for administration.
BPC-157 TB-500 Blend Nasal Spray is supplied solely as a laboratory research material and is not intended for human or animal consumption or administration, or for diagnostic, therapeutic, clinical or veterinary use.
Benefits of the nasal spray format
1
The dispensing is pre-measured. Each time the spray mechanism is actuated, it releases a constant volume, which allows for repeatable dispensing when carrying out research procedures.
2
Convenient format. Compact spray bottles are straightforward to store, handle, and transport within an appropriate research environment.
3
Ready to use. Unlike lyophilized peptides, which are provided in vials, nasal spray formulations are in liquid form and do not need to be reconstituted before being handled in the laboratory.
4
Protected storage. The bottle protects the formulation by preventing unnecessary handling and exposure to the environment between research procedures.
5
Simple dispensing. The product can be dispensed easily. With an integrated spraying mechanism, it is not necessary to draw the liquid from a vial, offering a simple way to dispense the formulation during research.
Read the BPC-157 TB500 research guide ▸
Read the BPC-157 TB500 research guide ▸
BPC-157 TB500 is supplied exclusively for laboratory research use. The information on this page is provided for scientific and educational reference and is based on available published research. This product is not intended for human or veterinary use, diagnosis, treatment, or prevention of any disease or medical condition. It is intended solely for qualified laboratory research and must be handled in accordance with applicable laboratory safety requirements.
Buy BPC-157 TB500 Blend Nasal Spray Estonia from Direct SARMS.
Additional information
| Size(s) | 15ml and 30ml |
| Amount Per Nasal | 15ml = 20mg (10mg BPC-157 and 10mg TB500)| 30ml = 40mg (20mg BPC-157 and 20mg TB500) |
| Physical Form | Pre-mixed aqueous solution |
| Purity | 99.1% |
| Molecular Formula | C62H98N16O22 |
| Molecular Weight | 1419.5 g/mol |
| Sequence | GEPPPGKPADDAGLV |
| Purity | 98.8% |
| Molecular Formula | C212H350N56O78S |
| Molecular Weight | 4963.44 g/mol |
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
General information
Applies to all Direct Sarms research compounds unless noted otherwise on the product.
Storage & handling
Store the nasal spray according to the instructions provided on the product label. Keep the bottle securely closed when not in use and protect it from excessive heat and direct light. Follow any product-specific refrigeration requirements stated on the label.
Shipping & discretion
Fully tracked dispatch with worldwide shipping available. Sent in plain, discreet outer packaging with no product description on the label.
FDA disclosure & intended use
These statements have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure or prevent any disease. Research use only — not for human or animal consumption. You must be 18+ and a qualified researcher.
Got a question about this BPC-157 TB500 compound?
BPC-157 TB-500 Blend Nasal Spray is supplied as a pre-mixed aqueous solution containing both research peptides in a single liquid formulation, rather than as separate dry or lyophilised materials.
Direct SARMs supplies the BPC-157 TB-500 Blend Nasal Spray in 15 ml and 30 ml formats, with equal stated quantities of BPC-157 and TB-500 within each formulation.
The formula includes two different synthetic peptides: BPC-157, a peptide composed of 15 amino acids and having the sequence GEPPPGKPADDAGLV, and TB-500, which is generally known to be the N-acetylated seven-amino-acid fragment of thymosin beta-4, Ac-LKKTETQ.
No. TB-500 and full-length thymosin beta-4 are different molecular entities. TB-500 corresponds to the short Ac-LKKTETQ region associated with residues 17–23 of thymosin beta-4, whereas full-length human thymosin beta-4 contains 43 amino-acid residues. Research involving the complete protein should therefore not automatically be attributed to the TB-500 fragment.
On the contrary, the two peptides have had separate research backgrounds, and the fact that they are included in the same pre-mixed formulation does not prove that there is synergy or any specific biological effect. One should not assign to the BPC-157/TB-500 mixture the results obtained from studies of each peptide separately or from studies using full-length thymosin beta-4 unless those findings are based on research that specifically looks at this combination.
Certificate of Analysis
| Identity | BPC-157 TB500 |
| Purity (HPLC) | 98.8% |
| Mass (LC-MS) | 4963.44 g/mol |
| Appearance | Pre-mixed aqueous solution |
COA · PDF
